DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstO3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:220 Identity:52/220 - (23%)
Similarity:80/220 - (36%) Gaps:63/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE---DDGH-Y 64
            |.||.:...|..:...|.|.|..|||..|.:|...|   .|..::.:|...||.|:   :.|. .
  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK---PEWLVEVSPLLKVPALQLVAEKGEPS 83

  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPK 129
            :.:|..|..||..||.: :.|.|||.|:||                             |..|..
  Fly    84 LIESLIIAEYLDDKYPE-NPLLPKDPLKRA-----------------------------QDKILL 118

  Fly   130 ERYDAIIEVY-----------------DFLEKFLA--GNDYVAGNQLTIADFSI------ISTVS 169
            ||:.:|...:                 |..|:.|.  |..|..||:....|:.|      :|.:.
  Fly   119 ERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIE 183

  Fly   170 -SLEVFVKVDTTKYPRIAAWFKRLQ 193
             .|:.....:.:::|:|..|...|:
  Fly   184 LKLQKEYNFNESRFPKITKWIALLK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 52/220 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/76 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/129 (18%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/75 (29%)
GstA 22..209 CDD:223698 52/220 (24%)
GST_C_Omega 109..230 CDD:198293 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.