DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstE5

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:222 Identity:155/222 - (69%)
Similarity:188/222 - (84%) Gaps:0/222 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |.||.|||:..||||||||||||||::|||||.||...:|..|||:|||||:||||||||||:||
  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65

  Fly    66 WDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKE 130
            ||||||||||||||..:|:|||:|||||||||||||||:||:|||.:::||||||......||||
  Fly    66 WDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE 130

  Fly   131 RYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL 195
            |||||:|:|||:|.||||:||:||:||||||||:||:::||..||::|..|||||..|.:||:||
  Fly   131 RYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKL 195

  Fly   196 PYYEEANGNGARTFESFIREYNFTFAS 222
            |||||||..|||..|:.::..|||||:
  Fly   196 PYYEEANAKGARELETILKSTNFTFAT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 56/72 (78%)
GST_C_Delta_Epsilon 91..209 CDD:198287 81/117 (69%)
GstE5NP_611327.1 GstA 4..210 CDD:440390 147/205 (72%)

Return to query results.
Submit another query.