DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstE10

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:215 Identity:118/215 - (54%)
Similarity:153/215 - (71%) Gaps:1/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |..|||||.|:|||||||.|||.||::.:||..::.:|.::...:.|:||||||||.|||....|
  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65

  Fly    66 WDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKE 130
            |||||||.|||:||.::|.|||||.|:|||||||||||:||:|....:.:.:.||....|.:||:
  Fly    66 WDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKD 130

  Fly   131 RYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEV-FVKVDTTKYPRIAAWFKRLQK 194
            |...:.:.|..||:|||.|.||||.|||||||||::|||:|.: :..||.||||:::||..|:..
  Fly   131 RLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISA 195

  Fly   195 LPYYEEANGNGARTFESFIR 214
            ||:|||.|..|||.....||
  Fly   196 LPFYEEDNLRGARLLADKIR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 106/192 (55%)
GST_N_Delta_Epsilon 4..77 CDD:239343 43/72 (60%)
GST_C_Delta_Epsilon 91..209 CDD:198287 63/118 (53%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 106/192 (55%)
GST_N_Delta_Epsilon 4..77 CDD:239343 43/72 (60%)
GST_C_Delta_Epsilon 91..211 CDD:198287 63/119 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467982
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1211.800

Return to query results.
Submit another query.