DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstE14

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:228 Identity:77/228 - (33%)
Similarity:128/228 - (56%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIW 66
            ||.|||..|.|||||:..:.:..|::..|...||....|.|.::||..||||:||||......:.
  Fly     4 PKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLT 68

  Fly    67 DSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIF---ANALRSITKPLFAGKQTMIP 128
            |||||:.:|..|:.:..||:|::..:|..|...|.||...:|   ::.:.:..:..||.......
  Fly    69 DSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHH 133

  Fly   129 KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQ 193
            :.:   :.|.|..:|::|..:|::||.|||:||.||::|:|::.:...:  :::||:..||..:|
  Fly   134 ERK---LTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRWFTAMQ 193

  Fly   194 KLPYYEEANGNG----ARTFESFIREYNFTFAS 222
            :|..| |||.:|    .:|.|| :..:.|..:|
  Fly   194 QLDAY-EANCSGLEKLRQTMES-VGSFQFPSSS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 64/194 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/124 (28%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 66/199 (33%)
GST_N_Delta_Epsilon 6..79 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..209 CDD:198287 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.