DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstT1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:228 Identity:60/228 - (26%)
Similarity:111/228 - (48%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLE-ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHY 64
            |.|.|.|..: .|.|.||:.:.:...:.|:|...|..|.:|..::|:...|....||.:.|....
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65

  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRL---HFESGVIFANALRSI----TKPLFAG 122
            :.:|.:|:.||..|...::.||||.|.:||.||:.|   ||...::.:...|.:    .|.|...
  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPA 130

  Fly   123 KQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVF-VKVDTTKYPRIA 186
            .:....|:....:......||:.....|::.|::||:||....|.::.:::. ..|:..::|::|
  Fly   131 PKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVA 195

  Fly   187 AWFKRLQKL--PYYEEANGNGARTFESFIREYN 217
            .|.:|::..  |||:||:....:|.:..::..|
  Fly   196 KWMERVRDATNPYYDEAHSFVYKTSQQAVKAKN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 51/202 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/127 (24%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 51/198 (26%)
GST_N_Theta 5..80 CDD:239348 20/74 (27%)
GST_C_Theta 93..218 CDD:198292 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.