DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and clic1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:190 Identity:35/190 - (18%)
Similarity:61/190 - (32%) Gaps:68/190 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFL---------KKNPQHTVPT 57
            |..:|||.|                     |:.:|...|.|.||.|         ..||:.....
Zfish    64 PPFLLYGTE---------------------VKTDTNKIEEFLEETLCPPKYPRLAACNPESNTAG 107

  Fly    58 LEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAG 122
            |:            :....|.|.|..:....|.|::.::             .||:.:...|.:.
Zfish   108 LD------------VFSKFSAYIKNSNPQMNDNLEKGLL-------------KALKKLDDYLSSP 147

  Fly   123 KQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            ....|.:...|.:|.         :...::.|.:||:||.:::..:.    .|||...|:
Zfish   148 LPDEIDENSADDVIS---------STRSFLDGQELTLADCNLLPKLH----IVKVVCLKF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 34/188 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/81 (17%)
GST_C_Delta_Epsilon 91..209 CDD:198287 16/92 (17%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 12/49 (24%)
O-ClC 6..241 CDD:129941 35/190 (18%)
GST_C_CLIC1 100..238 CDD:198333 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.