DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstT4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:213 Identity:43/213 - (20%)
Similarity:96/213 - (45%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKK-NPQHTVPTLEDDGHYIWDSHAIIAYLVSKY 79
            ||:.:.|.|.::|:|.:.::....|:.:.||... |....:|.:.|.|:.:.::.||..:|..:.
  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREK 81

  Fly    80 GKTDSLYPKDLLQRAVVDQRLHFES---GVIFANALR--------SITKPLFAGKQTMIPKERYD 133
            ...:..||:..|.|:.:|:.|.::.   ||......:        ..|:|  |.....:..::.:
  Fly    82 LVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRP--ADNAVNLASKQLE 144

  Fly   134 AIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL--P 196
            ..:.  :|.:.||....::.|:.::.||.|.|..:...:...........::|.|::.:::.  |
  Fly   145 HTLN--EFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREELGP 207

  Fly   197 YYEEANGNGARTFESFIR 214
            :|:|..|.    ||:.::
  Fly   208 HYKEVLGE----FEAKLK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 37/193 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/61 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/130 (18%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 16/62 (26%)
GST_C_Theta 95..220 CDD:198292 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.