DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gdap1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:274 Identity:57/274 - (20%)
Similarity:98/274 - (35%) Gaps:75/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            :||||....|...:.|:|.:|...:..|..:|:....|:....|::.|....||.|....:.|.:
  Rat    25 RLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89

  Fly    68 SHAIIAYLVSKY--GKTDSLYP-------------KDLLQRAVVDQRLHFESGVIFANAL----- 112
            :..||.||...:  .:|..|.|             ::||....:|...|   |.|....|     
  Rat    90 ATQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTH---GCILHPELTVDSM 151

  Fly   113 ----------------RSITKPL----------FAGKQTMIPKERYD-----AIIEVYDFLEKFL 146
                            .|..|.|          :..||..:..:..|     .:.::.|.|||.|
  Rat   152 IPAYATTRIRGQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVL 216

  Fly   147 ----------------AGND-YVAGNQLTIADFSIISTVSSLEV--FVKVD--TTKYPRIAAWFK 190
                            .||. ::.|...|:||.|:..|:..|:.  |.:.:  ..|.|.:.::::
  Rat   217 DQVETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLESYYE 281

  Fly   191 RLQKLPYYEEANGN 204
            |:.|...:.:..|:
  Rat   282 RVLKRKTFNKVLGH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/263 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/171 (19%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 56/268 (21%)
GST_N_GDAP1 26..98 CDD:239350 20/71 (28%)
GST_C_GDAP1 179..289 CDD:198336 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.