DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic6

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:157 Identity:31/157 - (19%)
Similarity:64/157 - (40%) Gaps:41/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VEVNTRAKENFSEEFL------KKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDL 90
            |:.:....|.|.||.|      |...||  |.....|:.::...:  |::.:.....:.:|.|:|
  Rat   445 VKTDVNKIEEFLEEKLVPPRYPKLGTQH--PESNSAGNDVFAKFS--AFIKNTKKDANDIYEKNL 505

  Fly    91 LQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGN 155
            |:                  ||:.:...|    .:.:|.|     |:.|...:..::...::.|:
  Rat   506 LR------------------ALKKLDSYL----NSPLPDE-----IDAYSTEDVTVSQRKFLDGD 543

  Fly   156 QLTIADFSIISTVSSLEVFVKVDTTKY 182
            :||:||.:::..:..:::..|    ||
  Rat   544 ELTLADCNLLPKLHIIKIVAK----KY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 31/157 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 12/50 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 16/92 (17%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 31/157 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.