DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:164 Identity:35/164 - (21%)
Similarity:63/164 - (38%) Gaps:47/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FVEVNTRAK------ENFSEE------FLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTD 83
            |:..|:..|      |.|.||      :||.:|:|  |.....|..|:...:  ||:.:...:.:
Mouse    77 FITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEAN 137

  Fly    84 SLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAG 148
            ....:.||:..   |:|.           ..:..||        |.|..:..:|...|     :.
Mouse   138 EALERGLLKTL---QKLD-----------EYLNSPL--------PDEIDENSMEDIKF-----ST 175

  Fly   149 NDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            ..::.|:::|:||.:::..:.    .|||...||
Mouse   176 RRFLDGDEMTLADCNLLPKLH----IVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 35/164 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/57 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 18/92 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 7/23 (30%)
O-ClC 17..252 CDD:129941 35/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.