DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:230 Identity:50/230 - (21%)
Similarity:92/230 - (40%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVS 77
            |..:.:.:.|....||:....|:||...:..::|.   |...:|.|..||....|:..|..:|..
  Rat    24 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEE 85

  Fly    78 KYGKTD--SLYPK---------DLLQR--AVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPK 129
            ..|..|  .|.|:         |:..:  |.:...:..:...::...||::|:           .
  Rat    86 TLGPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTR-----------L 139

  Fly   130 ERYDAIIEVYDFLEKFLAGNDYVA--------GNQLTIADFSIISTVSSLEVFVKVDTTKYPRIA 186
            :||     :...|:..||...:::        |:|||:||.|::   ..|.:   |||     :.
  Rat   140 DRY-----LGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLL---PKLHI---VDT-----VC 188

  Fly   187 AWFKRLQKLPYYEEANGNGARTF-ESFIREYNFTF 220
            |.| |.:.:|    |..:..|.: :|.::|..|.:
  Rat   189 AHF-RQRPIP----AELSCVRRYLDSALQEKEFKY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 44/203 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/63 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/127 (20%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.