DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTZ1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:201 Identity:65/201 - (32%)
Similarity:101/201 - (50%) Gaps:9/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVN--TRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |.|||....|.....|::.||...:.||.|.:|  ....:.||::|...||...||||:.||..|
Human     6 KPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITI 70

  Fly    66 WDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKE 130
            ..|.|||.|| .:...|..|.|:|..:||.|.......:|.|  ..|::::.....|::..:...
Human    71 HQSLAIIEYL-EEMRPTPRLLPQDPKKRASVRMISDLIAGGI--QPLQNLSVLKQVGEEMQLTWA 132

  Fly   131 RYDAIIEVYDFLEKFL--AGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQ 193
            : :||...::.||:.|  ....|..|:::|:||..::..|::.|.| |||.|.||.|::..|||.
Human   133 Q-NAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERF-KVDLTPYPTISSINKRLL 195

  Fly   194 KLPYYE 199
            .|..::
Human   196 VLEAFQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 63/195 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/74 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/111 (28%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 64/199 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.