DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTT1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:205 Identity:57/205 - (27%)
Similarity:100/205 - (48%) Gaps:26/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLE-----ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            |||     .|.|.|||.:.....::|:|...|:....::.|:.|.:.||...||.|:|....:.:
Human     2 GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTE 66

  Fly    68 SHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRS----ITKPLFAGK----Q 124
            |.||:.||..||...|..||:||..||.||:.|.::...:..:.||:    :..|:|.|:    |
Human    67 SVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQ 131

  Fly   125 TMIPK-ERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTV-----SSLEVFVKVDTTKYP 183
            |:... ...|..:::.:  :|||....::.|..:::||...|:.:     :..:||     ...|
Human   132 TLAATLAELDVTLQLLE--DKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVF-----EGRP 189

  Fly   184 RIAAWFKRLQ 193
            ::|.|.:|::
Human   190 KLATWRQRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 57/205 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/117 (22%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 23/74 (31%)