DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:191 Identity:42/191 - (21%)
Similarity:74/191 - (38%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VRAVKLTLAALEV---PYE-----------FVEVNTRAKENF--SEEFLKKN---PQ--HTVPTL 58
            ::.||..:..::.   |.|           |:..|...|.:|  .||||:|.   |:  |..|..
  Rat    42 LKGVKFNVTTIDTARKPEELKDLAPGTNPPFLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKY 106

  Fly    59 EDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVI--FANALRSITKPLFA 121
            :       :|..:...|.:|:    |.|.|:..:.|    ..:||..::  |......:..||..
  Rat   107 K-------ESFDVGCNLFAKF----SAYIKNTQKEA----NKNFEKSLLREFKRLDDYLNTPLLD 156

  Fly   122 GKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            .             |:.....|:.|:...::.|:|||:||.|::..::    .:||...||
  Rat   157 E-------------IDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 42/191 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/82 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/94 (21%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 13/53 (25%)
GST_N_CLIC 9..99 CDD:239359 14/56 (25%)
O-ClC 12..245 CDD:129941 42/191 (22%)
GST_C_CLIC2 106..244 CDD:198331 26/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.