DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gst1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:68/228 - (29%)
Similarity:95/228 - (41%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED---DG 62
            |.:..|:.....|....|...|..|::.||...||....|..|.|.|..||...||||.|   :.
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNND 65

  Fly    63 HYIWDSHAIIAYLVSKYGKTDSL-YPKDLLQRAVVDQRLHFES---GVIFANA-----------L 112
            :.||:|.||:.||..||.....: .|:|..:...|.|.|.|::   |:|:..|           :
pombe    66 YTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVI 130

  Fly   113 RSITKPLFAGKQTMIPKERY-DAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFV- 175
            .:||              || :.|..|...||..|...||:..|:.||||.|.||..:.||:.. 
pombe   131 SAIT--------------RYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFA 181

  Fly   176 -----------KVDTTK-YPRIAAWFKRLQKLP 196
                       ::|..| :||..:|.:||...|
pombe   182 EGKFSIEEEVPQLDFEKEFPRTYSWHQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 66/223 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/75 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/134 (27%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 29/80 (36%)
GstA 5..218 CDD:223698 67/224 (30%)
GST_C_Ure2p 96..219 CDD:198326 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.