DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:282 Identity:57/282 - (20%)
Similarity:100/282 - (35%) Gaps:106/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PK--LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHY 64
            ||  |:||....|...:.|:|.:|...:..|..:|:....|:....|::.|....||.:....:.
Mouse    43 PKESLVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNI 107

  Fly    65 IWDSHAIIAYL-----------------------VSKYGK---------------------TDSL 85
            |.|...||.|:                       |.:|.:                     |||:
Mouse   108 ISDYDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSM 172

  Fly    86 YPKDLLQRAVVDQRLHFESGVIFANALRSITK-----------PLFAGKQTMIPKERYDAIIEVY 139
            .||    .|..:.|.|      .|||...:.|           |..:.::.::.|     |:|..
Mouse   173 IPK----YATAEIRRH------LANATTDLMKLDHEEEPQLSEPYLSKQKKLMAK-----ILEHD 222

  Fly   140 D--FLEKFLA------------------GND------YVAGNQLTIADFSIISTVSSLEVFVKVD 178
            |  :|:|.|.                  .|:      ::.|...|:||..:.:|:..|: |:.: 
Mouse   223 DVSYLKKILGELAMVLDQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLK-FLGL- 285

  Fly   179 TTKY------PRIAAWFKRLQK 194
            :.||      |.:.::|:|:|:
Mouse   286 SKKYWEDGSRPNLQSFFERVQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 55/278 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/95 (20%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/147 (20%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 55/278 (20%)
GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_family 201..311 CDD:295467 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.