powered by:
Protein Alignment GstE7 and Clic5
DIOPT Version :9
Sequence 1: | NP_611329.1 |
Gene: | GstE7 / 37112 |
FlyBaseID: | FBgn0063493 |
Length: | 223 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006524198.1 |
Gene: | Clic5 / 224796 |
MGIID: | 1917912 |
Length: | 485 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 22/47 - (46%) |
Gaps: | 11/47 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 VSSLEVFVKVDTT--KYPRIAAWFKRLQKLPYYEEANGNGARTFESF 212
|:.:|.|::...| |||::|| .:.|:|..|...|..|
Mouse 319 VNKIEEFLEETLTPEKYPKLAA---------KHRESNTAGIDIFSKF 356
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167844838 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.