DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic5

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:47 Identity:14/47 - (29%)
Similarity:22/47 - (46%) Gaps:11/47 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VSSLEVFVKVDTT--KYPRIAAWFKRLQKLPYYEEANGNGARTFESF 212
            |:.:|.|::...|  |||::||         .:.|:|..|...|..|
Mouse   319 VNKIEEFLEETLTPEKYPKLAA---------KHRESNTAGIDIFSKF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..209 CDD:198287 12/42 (29%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.