| Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
| Alignment Length: | 47 | Identity: | 14/47 - (29%) |
|---|---|---|---|
| Similarity: | 22/47 - (46%) | Gaps: | 11/47 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 168 VSSLEVFVKVDTT--KYPRIAAWFKRLQKLPYYEEANGNGARTFESF 212 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE7 | NP_611329.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | |
| GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 12/42 (29%) | ||
| Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 14/47 (30%) |
| Blue background indicates that the domain is not in the aligned region. | |||||