| Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
| Alignment Length: | 268 | Identity: | 51/268 - (19%) |
|---|---|---|---|
| Similarity: | 88/268 - (32%) | Gaps: | 97/268 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE-DDGHYIWDSH 69
Fly 70 AIIAYLVSKYG-KTDSLYPKDLLQRAVVDQRLHFES---GVIFANALRSITKPLFAGKQTMIPKE 130
Fly 131 RYDAIIEVYDFLEKFLAGND--YVAGNQLTIAD---------------------------FSIIS 166
Fly 167 T----------------VSSLEVFVKVDTTKYP---------------------------RIAAW 188
Fly 189 FKRLQKLP 196 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE7 | NP_611329.1 | GstA | 4..196 | CDD:223698 | 49/266 (18%) |
| GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 21/71 (30%) | ||
| GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 27/181 (15%) | ||
| Mars1 | NP_001165053.1 | Thioredoxin_like | 1..68 | CDD:294274 | 20/68 (29%) |
| GstA | <47..189 | CDD:223698 | 29/159 (18%) | ||
| GST_C_MetRS_N | 77..179 | CDD:198340 | 18/117 (15%) | ||
| PRK12268 | 266..821 | CDD:237029 | |||
| MetRS_core | 267..635 | CDD:173907 | |||
| 'HIGH' region | 275..285 | ||||
| 'KMSKS' region | 595..599 | ||||
| Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
| MetRS_RNA | 855..899 | CDD:238475 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||