DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:224 Identity:64/224 - (28%)
Similarity:101/224 - (45%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            |.|||...:|.....|:..||..::.||:..||...|:. .:||...||...||.|:.:|..:.:
 Worm     4 KPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK-EQEFHGNNPAEKVPILKINGLTLTE 67

  Fly    68 SHAIIAYLVSKYGKTDSLYPKDLL----------QRAVVDQRLHFESGVIFANALRSITKPLFAG 122
            |.|||.||       |.:||...|          .||:.   .|..|.:   ..|::  ||::  
 Worm    68 SMAIIEYL-------DEIYPDPPLLPKEPELKARARAIA---FHIASNI---QPLQN--KPIY-- 115

  Fly   123 KQTMIPKERYDA---------IIEVYDFLEKFLA--GNDYVAGNQLTIADFSIISTV-SSLEVFV 175
               ::..|:...         |.:.:..||:.|.  ..|:..|||::|||..:.|.| :::|.: 
 Worm   116 ---LMLNEKEPGYGDFWCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKY- 176

  Fly   176 KVDTTKYPRIAAWFKRLQKLPYYEEANGN 204
            .||.|.||.|.....:|.:||.::.|:.|
 Worm   177 HVDMTPYPIITRISNKLAELPEFQVAHPN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 59/213 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/136 (25%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 26/78 (33%)
maiA 18..211 CDD:273527 59/210 (28%)
GST_C_Zeta 89..207 CDD:198300 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.