DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gst-15

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:191 Identity:56/191 - (29%)
Similarity:80/191 - (41%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP--KLILYGLE--ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDD 61
            ||  ||..:.|.  |.|..:...|:    ..||:.:.:.....|...|:...|.|...:|.|..|
 Worm     1 MPQYKLTYFDLRGWAEPARQLFHLS----HTPYDDIRIPMADTEGKWEKMRDKTPFGQLPVLNVD 61

  Fly    62 GHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGK-QT 125
            |..|..|.||..||..|:|.......::....|||||   |:.   |:.|.:::.....||| :.
 Worm    62 GFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQ---FKD---FSVAFKTLLFATRAGKPEE 120

  Fly   126 MIPKERYDAIIEVYD--------FLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVD 178
            .|.|.||:......|        .|:|..:|  |:.|:.||.||..|...:.|||....:|
 Worm   121 EILKIRYEIFNPARDVYFILLNRILKKSKSG--YLVGDGLTWADLVIADNLHSLEKLRAID 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 53/186 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/74 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/97 (31%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 22/76 (29%)
PTZ00057 6..211 CDD:173353 53/186 (28%)
GST_C_Sigma_like 87..195 CDD:198301 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.