DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and eef-1G

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_505800.1 Gene:eef-1G / 179522 WormBaseID:WBGene00008920 Length:398 Species:Caenorhabditis elegans


Alignment Length:175 Identity:33/175 - (18%)
Similarity:68/175 - (38%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESG----VIFA 109
            |.|....|..|.|. .::.:.:|..:|.......:::            |.|.|..|    .:..
 Worm    39 KFPLGVTPAFEGDA-LLFGAESIGLHLTGTSANAETV------------QWLQFAEGYLLPAVLG 90

  Fly   110 NALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSI-ISTVSSLEV 173
            ..|.|::...|..|.....|...:..::|   |::.|....|:.|.:|::||.|: :..:.:.:.
 Worm    91 YVLPSVSAANFDKKTVEQYKNELNGQLQV---LDRVLVKKTYLVGERLSLADVSVALDLLPAFQY 152

  Fly   174 FVKVDTTK-YPRIAAWFKRLQKLPYYEEANGNGARTFESFIREYN 217
            .:..:..| ...:..||:.:...|..:|..|.  .:..|.:.::|
 Worm   153 VLDANARKSIVNVTRWFRTVVNQPAVKEVLGE--VSLASSVAQFN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 28/152 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 7/27 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/123 (20%)
eef-1GNP_505800.1 GST_N_EF1Bgamma 3..77 CDD:239342 8/50 (16%)
GstA 4..181 CDD:223698 29/157 (18%)
GST_C_EF1Bgamma_like 71..188 CDD:198290 24/133 (18%)
EF1G 238..343 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.