DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gst-27

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:206 Identity:50/206 - (24%)
Similarity:88/206 - (42%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIW 66
            |..||:.| |..|....::|:.  :..:|    |.:||..|.:          .|.|..||..|.
 Worm    17 PARILFHL-ADVPFEDFRMTIG--DGTWE----NLKAKTPFGQ----------APVLSVDGFEIP 64

  Fly    67 DSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQT------ 125
            .|.||..||..::|.......:.....|:|||...      |..:::.:.|...|||..      
 Worm    65 QSAAINRYLAKQFGYAGKTPEEQAWTDAIVDQYKD------FMVSIKEVGKASAAGKSAEEVGKI 123

  Fly   126 ----MIP-KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRI 185
                ::| ::.:..||.  ..|||..:|  ::.|:.|||||..|:..:::|:.......::.|::
 Worm   124 IQSDLVPARDAFFVIIN--KILEKSKSG--FLVGDGLTIADIVIVECITTLDKHQLFTASEQPKL 184

  Fly   186 AAWFKRLQKLP 196
            .|..:::..:|
 Worm   185 VALREKVYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 48/202 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/117 (23%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 22/74 (30%)
PTZ00057 6..208 CDD:173353 50/206 (24%)
GST_C_Sigma_like 85..191 CDD:198301 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.