DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and exl-1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:38 Identity:8/38 - (21%)
Similarity:22/38 - (57%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LEKFLAGND--YVAGNQLTIADFSIISTVSSLEVFVKV 177
            |:|:|:..:  ::..:.:|..|..:::.:.|:.|..|:
 Worm   133 LDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 8/38 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..209 CDD:198287 8/38 (21%)
exl-1NP_497000.1 O-ClC 2..213 CDD:129941 8/38 (21%)
GST_C_family 98..210 CDD:295467 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.