DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gsto1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:216 Identity:50/216 - (23%)
Similarity:91/216 - (42%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED-DGHYIWDSH 69
            :|.:...|..:...:.|.|..:.:|.:.:|.:   |..|.|.:|||...||.||: .||.:.:|.
Mouse    26 VYSMRFCPFAQRTLMVLKAKGIRHEVININLK---NKPEWFFEKNPLGLVPVLENSQGHLVTESV 87

  Fly    70 AIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFES----GVIFANALRSITKPLFAGKQTMIPKE 130
            ....||...|.: ..|:|.|..::|  .|::..||    ..:.|:.:||..|......:..:..|
Mouse    88 ITCEYLDEAYPE-KKLFPDDPYKKA--RQKMTLESFSKVPPLIASFVRSKRKEDSPNLREALENE 149

  Fly   131 RYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL 195
             :..:.|..|..:.||.|:.....:.||...|..:..:...|.....     |::..|...:|:.
Mouse   150 -FKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHT-----PKLKLWMAAMQQD 208

  Fly   196 PYYEEANGNGARTFESFIREY 216
            | ...::...|:|:..::..|
Mouse   209 P-VASSHKIDAKTYREYLNLY 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 46/194 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/71 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/121 (19%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 20/70 (29%)
GstA 26..224 CDD:223698 49/210 (23%)