DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and AIMP3

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:68 Identity:15/68 - (22%)
Similarity:34/68 - (50%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTV-SSLEVFVKVDTTKYPRIAAWFKRL 192
            |:::.| ..:.|.|..:|....|:..:.|::||..:..|: .::.....::...:..::.||..|
Mosquito    88 KDKHTA-KSLLDELNFYLQSRSYLVNDTLSVADVVVFHTIHETMANLQPLEKENFLNVSRWFHHL 151

  Fly   193 QKL 195
            |:|
Mosquito   152 QQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..209 CDD:198287 15/68 (22%)
AIMP3XP_061501516.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.