DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTO2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:193 Identity:43/193 - (22%)
Similarity:81/193 - (41%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE-DDGHYIWDSH 69
            :|.:...|.....:|.|.|.::.:|.|.:|.|   |..|.:..|:|...:|.|| .....|::|.
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINLR---NKPEWYYTKHPFGHIPVLETSQCQLIYESV 87

  Fly    70 AIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYD 133
            ....||...| |:  .|:|.|..:||  .|::..|......:..:.....|..|::....|.   
Human    88 IACEYLDDAYPGR--KLFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGRECTNLKA--- 145

  Fly   134 AIIEVYDFLEKFL--AGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY-PRIAAWFKRLQ 193
            |:.:.:..||:.|  ....:..|..:::.|:.:......|:|:..:|...: |.:..|...::
Human   146 ALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 43/193 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 18/106 (17%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/70 (27%)