DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gsto1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:221 Identity:56/221 - (25%)
Similarity:101/221 - (45%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED-DGHYIWDSH 69
            :|.:...|..:...:.|.|..:.:|.:.:|.:   |..|.|.:|||...||.||: .||.|.:|.
  Rat    26 VYSMRFCPFAQRTLMVLKAKGIRHEIININLK---NKPEWFFEKNPFGLVPVLENTQGHLITESV 87

  Fly    70 AIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDA 134
            ....||...|.: ..|:|.|..::|.  |::.||   :|:.....:|..:.|.:     ||.:..
  Rat    88 ITCEYLDEAYPE-KKLFPDDPYEKAC--QKMTFE---LFSKVPSLVTSFIRAKR-----KEDHPG 141

  Fly   135 IIE----VYDFLEKFLA--GNDYVAGNQLTIADFSI---ISTVSSLEVFVKVDTTKYPRIAAWFK 190
            |.|    .:..||:.:|  ...:..||.|::.|:.|   ...:.:||:...:|.|  |::..|..
  Rat   142 IKEELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHT--PKLKLWMA 204

  Fly   191 RLQKLPYYEEANGNGARTFESFIREY 216
            .:|:.| ...::...|:|:..::..|
  Rat   205 TMQEDP-VASSHFIDAKTYRDYLSLY 229

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 52/199 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/71 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/126 (22%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/70 (30%)
GstA 26..214 CDD:223698 53/204 (26%)