DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:188 Identity:37/188 - (19%)
Similarity:68/188 - (36%) Gaps:70/188 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILYGLEASPPVRAVKLTLAALEVPYEF-------VEVNTRAKENFSE--EFLKKNPQHTVPTLED 60
            :|||.|.......::..|.|:..|..:       .|.||...:.|::  .::|    ::.|.|.|
Mouse    67 LLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIK----NSNPALND 127

  Fly    61 DGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQR-AVVDQRLHFESGVIFANALRSITKPLFAGKQ 124
            :                        ..|.||:. .|:|..|               |.||     
Mouse   128 N------------------------LEKGLLKALKVLDNYL---------------TSPL----- 148

  Fly   125 TMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
               |:|..:...|     ::.::...::.||:||:||.:::..:..::|..|    ||
Mouse   149 ---PEEVDETSAE-----DEGISQRKFLDGNELTLADCNLLPKLHIVQVVCK----KY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 37/188 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/80 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/93 (22%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 6/22 (27%)
O-ClC 6..241 CDD:129941 37/188 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.