DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gstz1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:215 Identity:60/215 - (27%)
Similarity:92/215 - (42%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKE---NFSEEFLKKNPQHTVPTLEDDGHY 64
            |.:|||...|.....|::.||...:.|:...:|. .|:   ..|.|:.:.||...||.|..||..
 Frog     6 KPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINL-VKDGGMQLSNEYKQVNPMQQVPALCIDGVT 69

  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTM--- 126
            :..|.|||.|| .:......|.|:|..:||.|                |.|:..:.:|.|.:   
 Frog    70 LSQSLAIIEYL-EETRPNPPLLPRDPKKRAQV----------------RMISDQIASGIQPLQNL 117

  Fly   127 -----IPKERYD----AIIEVYDFLEKFL---AGNDYVAGNQLTIADFSIISTVSSLEVFVKVDT 179
                 |.:.:.:    .|...:..|||.|   ||. |..|:::||||..::..|::...| |||.
 Frog   118 CVLQKIGETKLEWAKHFITRGFQALEKLLQTTAGR-YCVGDEVTIADLCLVPQVANAVRF-KVDL 180

  Fly   180 TKYPRIAAWFKRLQKLPYYE 199
            ..||.|....:.|.:|..::
 Frog   181 APYPTIVGINESLLQLEAFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 58/209 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/124 (25%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 59/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.