DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and sspA

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:209 Identity:46/209 - (22%)
Similarity:85/209 - (40%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADS 82
            |::.||...:::|   ::.|.:.....:.::.||..:||||.|....:|:|..|:.||..:: ..
E. coli    25 VRIVLAEKGVSFE---IEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERF-PH 85

  Fly    83 DALYPKDPLKRAVVDQRLHF----ESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVE 143
            ..|.|..|:.|.  :.||:.    :......|.|.:.|.|.. ....|..:|...||..::....
E. coli    86 PPLMPVYPVARG--ESRLYMHRIEKDWYTLMNTIINGSASEA-DAARKQLREELLAIAPVFGQKP 147

  Fly   144 TFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYEEANGKGVRQ 208
            .||..            :||||      :.::|....:.|::|.            |.:|.|.::
E. coli   148 YFLSD------------EFSLV------DCYLAPLLWRLPQLGI------------EFSGPGAKE 182

  Fly   209 L----VAIFKKTNF 218
            |    ..:|::.:|
E. coli   183 LKGYMTRVFERDSF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 40/186 (22%)
sspANP_417696.1 sspA 1..211 CDD:236537 46/209 (22%)

Return to query results.
Submit another query.