DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Clic5

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:133 Identity:33/133 - (24%)
Similarity:53/133 - (39%) Gaps:39/133 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVL 120
            |.|..:|....|.:.|..:|      .:.|.|:...|.|.    .|.||...   ||...||   
  Rat    73 PFLTFNGDVKTDVNKIEEFL------EETLTPEKYPKLAA----RHRESNTA---GIDIFSK--- 121

  Fly   121 FQGQTKVPKERYDAIIE---------IYDFVETFL------------KG--QDYIAGNQLTIADF 162
            |....|..|::.:|.:|         :.|::.|.|            ||  :.::.|::||:||.
  Rat   122 FSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADC 186

  Fly   163 SLV 165
            :|:
  Rat   187 NLL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 33/133 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 6/20 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/98 (26%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 7/30 (23%)
O-ClC 14..249 CDD:129941 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.