DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and CLIC3

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:144 Identity:26/144 - (18%)
Similarity:51/144 - (35%) Gaps:58/144 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKY-ADSDALYPK--------DPLKRAVVD 97
            |:|.|.|.|..         |:.::  |...|::.:.. |..:|||.:        |...||.::
Human    94 LAPRYRESNTA---------GNDVF--HKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLE 147

  Fly    98 QRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADF 162
            ..|                     .|:.::.:.|                 :.::.|::||:||.
Human   148 HEL---------------------AGEPQLRESR-----------------RRFLDGDRLTLADC 174

  Fly   163 SLVSSVASLEAFVA 176
            ||:..:..::...|
Human   175 SLLPKLHIVDTVCA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 26/144 (18%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88
O-ClC 5..229 CDD:129941 26/144 (18%)
G-site. /evidence=ECO:0000305|PubMed:28198360, ECO:0000305|PubMed:37759794 22..25
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.