DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and CAM1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:48/195 - (24%)
Similarity:84/195 - (43%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ALNLTYEYVNVDIVARAQLSPEY-LEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYP 87
            ||.|..:.|..|..|. |.:.:: |:|.|....|    .|:.:.::.||..|||....|      
Yeast    23 ALKLDVKVVTPDAAAE-QFARDFPLKKVPAFVGP----KGYKLTEAMAINYYLVKLSQD------ 76

  Fly    88 KDPLKRAVV--DQRLHFESGVV----FANG---IRSISKSVLFQGQTKVPKE----RYDAIIEIY 139
             |.:|..::  |..|:.::.::    .||.   |:..:..|..:|.....|:    ..||:.:|.
Yeast    77 -DKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIV 140

  Fly   140 DFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTT----KYPRIGAWIKKLEQLPYYEE 200
            |..|..||...|:|...:::||  ||::......|.:|..|    ::|.|..|...:...|:.::
Yeast   141 DIFENRLKNYTYLATENISLAD--LVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKD 203

  Fly   201  200
            Yeast   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 47/189 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/53 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/127 (23%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 17/54 (31%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 26/114 (23%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.