DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and URE2

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:57/248 - (22%)
Similarity:89/248 - (35%) Gaps:73/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLED---DGHYIW 66
            ||:....:|....|.:.|:.|...|..:.:|.......:||::..||...||.|.|   |...||
Yeast   115 TLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIW 179

  Fly    67 DSHAIIAYLVSKYAD--------SDALYPKDPLK----------RAVVDQRLHFESGVVFANGIR 113
            :|.||:.:||:||..        ||.|..:..:.          ..::.|.|||.          
Yeast   180 ESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFR---------- 234

  Fly   114 SISKSVLFQGQTKVPK--ERY-DAIIEIYDFVETFLKGQ-------------------------- 149
                  .|..| |:..  ||| |.:..:|..||..|..:                          
Yeast   235 ------YFHSQ-KIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQS 292

  Fly   150 ---DY---IAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
               ||   :.|::|||||.:.|.....::........::|.:..|.|.:.:.|
Yeast   293 RFFDYPVWLVGDKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 56/246 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/151 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 26/78 (33%)
GST_C_Ure2p 208..350 CDD:198326 28/155 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.