DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and TEF4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:43/203 - (21%)
Similarity:84/203 - (41%) Gaps:22/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPT-LEDDGHYIWDS 68
            ||| ::.||...|.:..::...|..:.|::      :.|.|:....|....|. |...|..:.::
Yeast     5 TLY-INRSPRNYASEALISYFKLDVKIVDL------EQSSEFASLFPLKQAPAFLGPKGLKLTEA 62

  Fly    69 HAIIAYLVSKYADSD---ALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVL-FQGQTKVPK 129
            .||..||.::.||..   .|...|.::::.:.:.....:..|.:|    |::..| |:|.....|
Yeast    63 LAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSN----IARPFLSFKGLIPYNK 123

  Fly   130 ERYDA-IIEIYDFVETF---LKGQDYIAGNQLTIADFSLVSSVA-SLEAFVALD-TTKYPRIGAW 188
            :..|| .::|.:....|   |:...::|...:::.|.....|.| .|...:..: ..|:|.:..|
Yeast   124 KDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHPHLMRW 188

  Fly   189 IKKLEQLP 196
            ...:...|
Yeast   189 FNTVAASP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 42/201 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/113 (19%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 18/73 (25%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 21/112 (19%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.