DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and YGR201C

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:49/211 - (23%)
Similarity:83/211 - (39%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIW---DSHAII 72
            |...||::||            :|.:...:.....|..:.|....||.... |..|   ::.||.
Yeast    21 PRGLVRSLKL------------DVKLADPSDAQQLYEREFPLRKYPTFVGP-HDEWTLTEAMAID 72

  Fly    73 AYLVSKYADSDA----LYPKDPLKRAVVDQRLHFESGVVFAN----------GIRSISKSVLFQG 123
            .||:...:|.:|    |.|:...|......|....|...|.|          |::..:.:     
Yeast    73 YYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNAT----- 132

  Fly   124 QTKVPKERYDAIIEIYDFVETFLKGQDY-IAGNQLTIADFSLVSSVASLEAFVA-LDTT---KYP 183
            :.|..:|..|.|:.:|   |..||.|.| :..:..|:||  |:|:.|....|:: .|.|   |:|
Yeast   133 EFKAARENVDTIVSLY---EKRLKKQQYLVCDDHETLAD--LISAAAFSLGFISFFDETWRSKHP 192

  Fly   184 RIGAWIKKLEQLPYYE 199
            .:..|..::.:..::|
Yeast   193 EVTRWFNRVIKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 48/206 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/68 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/124 (23%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 16/69 (23%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.