DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GTT2

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:59/230 - (25%)
Similarity:111/230 - (48%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNL--TYEYVNVDIVARAQLSPEYLEKNPQHTVPTLE-DDGHY 64
            |:.:|.....|....|::.||..|:  :.::|.:::.......||:|.||...|||.|| |||..
Yeast    18 KMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTL 82

  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVV---DQRLHFE----SGVVFANGIRSISKSV-LF 121
            |.:..||..| :.....:..|..|.||::.|:   ::|...|    ..|.|.:....:...| |:
Yeast    83 IAECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELY 146

  Fly   122 QGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPR-- 184
            |.:....::|..|:..::.| :|.|:.:.|:||:..::||.::::.:    .|.|:...:.|.  
Yeast   147 QNKEWGLRQRDKALHGMHYF-DTVLRERPYVAGDSFSMADITVIAGL----IFAAIVKLQVPEEC 206

  Fly   185 --IGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTN 217
              :.||.|:::|.|        .|::|:.|..|::
Yeast   207 EALRAWYKRMQQRP--------SVKKLLEIRSKSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 53/206 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/75 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/129 (22%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 24/75 (32%)
GST_C_GTT2_like 106..222 CDD:198291 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345151
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.