DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF6

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:205 Identity:45/205 - (21%)
Similarity:86/205 - (41%) Gaps:12/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |..:.::|...|...|.|.:.|...|:.:|:|:|::.........::.:||...||..||....|
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVL--FQGQT--- 125
            ::|.||..|:..:::|............|::...:..||......|.:.:.:.||  ..|.|   
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDK 130

  Fly   126 KVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY----PRIG 186
            .|.:|....:.::.|..|..|....|:|.:..|:.|   :.::..::..:...|.|.    |.:.
plant   131 TVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVD---LHTIPVIQYLLGTPTKKLFDERPHVS 192

  Fly   187 AWIKKLEQLP 196
            ||:..:...|
plant   193 AWVADITSRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 43/200 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/115 (20%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 20/72 (28%)
GST_C_Phi 91..208 CDD:198296 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.