DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF5

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:223 Identity:56/223 - (25%)
Similarity:92/223 - (41%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHA 70
            :||...|...|.|...|....|:|:.:.|:::|..|..|.:|..||...||...|.|..:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 IIAYL--VSKYADSDALYPK-------------------DPLKRAVVDQRLHFESGVVFANGIRS 114
            |..|:  |.|...:..|..|                   |||     ...|.:|..:....|:::
plant   131 ISEYIATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPL-----TSTLTWEQSIKPMYGLKT 190

  Fly   115 ISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDT 179
            ..|.|   .:|:...|:   :::||   |..||...::|.|..|:||...:.::..|     :||
plant   191 DYKVV---NETEAKLEK---VLDIY---EERLKNSSFLASNSFTMADLYHLPNIQYL-----MDT 241

  Fly   180 -TK-----YPRIGAWIKKLEQLPYYEEA 201
             ||     .|.:..|:.::...|.::.|
plant   242 HTKRMFVNRPSVRRWVAEITARPAWKRA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 54/216 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/117 (23%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 23/69 (33%)
GST_C_Phi 153..270 CDD:198296 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.