DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:201 Identity:47/201 - (23%)
Similarity:80/201 - (39%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DP-SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIA 73
            || |...|.|...|....|:||.:.|.:......:..:|..||...||..||....:::|.||..
plant    42 DPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQ 106

  Fly    74 YL--VSKYADSDALYPKDPLKRAVVDQRLHFE--------SGVVFANGIRSISKSVLFQGQTKVP 128
            |:  |.....:..|..:.....|.:...:..|        |.:.:...|:.|..  |...|| :.
plant   107 YIAYVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYG--LETDQT-IV 168

  Fly   129 KERYDAIIE-IYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDT------TKYPRIG 186
            ||. :||:| :.:..|..|:...::|.|..|:.|...:.::..|     |.|      .|..::.
plant   169 KEN-EAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYL-----LGTPTKKLFEKRSKVR 227

  Fly   187 AWIKKL 192
            .|:.::
plant   228 KWVDEI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 47/201 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/69 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/117 (21%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/66 (32%)
GST_C_Phi 126..243 CDD:198296 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.