DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Clic4

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_114006.2 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:188 Identity:33/188 - (17%)
Similarity:64/188 - (34%) Gaps:70/188 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRL--HFESGV 106
            |:||:.:|:|  |.....|..|:...:  ||:.:...:::....:..||..   |:|  :..|.:
  Rat   102 PKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGLLKTL---QKLDEYLNSPL 159

  Fly   107 ---VFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSV 168
               :..|.:..|..|.                             :.::.|:::|:||.:|:..:
  Rat   160 PDEIDENSMEDIKSST-----------------------------RRFLDGDEMTLADCNLLPKL 195

  Fly   169 ASLEAFVALDTTKY-----PR--IGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFT 219
                ..|.:...||     |:  .|.|                  |.|...:.:..||
  Rat   196 ----HIVKVVAKKYRNFDIPKGMTGIW------------------RYLTNAYSRDEFT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 29/168 (17%)
Clic4NP_114006.2 Required for insertion into the membrane. /evidence=ECO:0000250 2..101
O-ClC 17..252 CDD:129941 33/188 (18%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.