DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Clic4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:185 Identity:33/185 - (17%)
Similarity:64/185 - (34%) Gaps:64/185 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKR-AVVDQRLHFE-SGV 106
            |:||:.:|:|  |.....|..|:...:  ||:.:...:::....:..||. ..:|:.|:.. .|.
  Rat   102 PKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGE 162

  Fly   107 VFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASL 171
            :..|.:..|..|.                             :.::.|:::|:||.:|:..:   
  Rat   163 IDENSMEDIKSST-----------------------------RRFLDGDEMTLADCNLLPKL--- 195

  Fly   172 EAFVALDTTKY-----PR--IGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFT 219
             ..|.:...||     |:  .|.|                  |.|...:.:..||
  Rat   196 -HIVKVVAKKYRNFDIPKGMTGIW------------------RYLTNAYSRDEFT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 29/160 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/32 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/126 (16%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101
GST_N_CLIC 14..104 CDD:239359 1/1 (100%)
O-ClC 17..252 CDD:129941 33/185 (18%)
GST_C_family 111..251 CDD:295467 29/176 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.