DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTT2

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:222 Identity:66/222 - (29%)
Similarity:103/222 - (46%) Gaps:27/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIW 66
            :||.:|....|.|.|||.:......:.::.:.:.:..|.|||||:.|.||...||.:.|....::
plant     1 MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLF 65

  Fly    67 DSHAIIAYLVSKYAD-SDALYPKDPLKRAVVDQRLHFE--------SGVVFANGIRSISKSVLFQ 122
            :||||:.||.|.||. .|..||.|..|||.:...|.:.        ||.|    :.|:....|  
plant    66 ESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYV----LNSVLAPAL-- 124

  Fly   123 GQTKVPK---ERYDAIIEIYDFVETF-LKG--QDYIAGNQLTIADFSLVSSVASLEAFVALDTTK 181
            |....||   |..:.:......:||| |||  :..:.|.|.:|||.|||..:..|:.....|..:
plant   125 GLPLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLR 189

  Fly   182 ----YPRIGAWIKKLEQ--LPYYEEAN 202
                :.::..||:...:  :|:.:|.:
plant   190 LLSPHKKVEQWIESTRKATMPHSDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 64/217 (29%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 26/74 (35%)
GST_C_Theta 92..221 CDD:198292 33/131 (25%)
NAM-associated 380..488 CDD:464129
DUF5401 <438..588 CDD:375164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.