DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTT1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:217 Identity:63/217 - (29%)
Similarity:102/217 - (47%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |:||.:|....|.|.|||.:......:.::.|.:.:..|.|||||:.:.||...||.:.|....:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 WDSHAIIAYLVSKYAD-SDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQG-----Q 124
            ::||||:.||.|.:.. :|..||.|..|||.:...|.:....:.......:..|||...     .
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLN 130

  Fly   125 TKVPKERYDAIIEIYDFVETF-LKGQ-DYIAG-NQLTIADFSLVSSVASLEAFVALDTTK----Y 182
            .|...|....:.:....:||| |||. .::.| ||.:|||.|||..:..|:.....|..:    :
plant   131 PKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTH 195

  Fly   183 PRIGAWIK--KLEQLPYYEEAN 202
            .::..||:  |...:|:::|.:
plant   196 KKVEQWIENTKKATMPHFDETH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/206 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/126 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 26/74 (35%)
GST_C_Theta 93..223 CDD:198292 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.