DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF12

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:222 Identity:47/222 - (21%)
Similarity:88/222 - (39%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHA 70
            |||...:...:.|.|......:.:|.:::|:....|..||:|.:.|...||.:||....:::|.|
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRA 69

  Fly    71 IIAYLVSKYADSDA-LYPKDPLKRAVVDQ------------------------RLHFESGVVFAN 110
            |..|..:|:||... |..|....||:|||                        ||..:..||...
plant    70 IARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLIIKPRLGEKCDVVLVE 134

  Fly   111 GIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFV 175
            .:                |.:...:::||:   ..|....::||.:.|:||.:.:.::..|.:..
plant   135 DL----------------KVKLGVVLDIYN---NRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT 180

  Fly   176 ALDTTKYPR--IGAWIKKLEQLPYYEE 200
            .::.....|  ...|.:::...|.:::
plant   181 DINQMVKARGSFNRWWEEISDRPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 46/216 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/70 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/136 (16%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 47/222 (21%)
GST_N_Phi 2..77 CDD:239351 20/71 (28%)
GST_C_Phi 91..209 CDD:198296 22/136 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.