DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:212 Identity:60/212 - (28%)
Similarity:96/212 - (45%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            :.|||.:.|..|..|.|.|...|..:|.|.|::.|.....|.:|..||...||.|:||...:::|
plant     3 MKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFES 67

  Fly    69 HAIIAYLVSKYAD--SDALYPKDPLKRAVVD-----QRLHFE---SGVVFANGIRSISKSVLFQG 123
            .||.||:..|:.|  :|....:||.:.|:|.     :..||.   |.|:....:      |..||
plant    68 RAITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIV------VPLQG 126

  Fly   124 QT---KVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVS----SVASLEAFVALDTTK 181
            ::   .:.:|..:.:.:|.|..|..|....|:||:..|:||...|.    .:.::.|.:..|.  
plant   127 ESPNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLINDR-- 189

  Fly   182 YPRIGAWIKKLEQLPYY 198
             |.:.||.:.|...|.:
plant   190 -PNVKAWWEDLCSRPAF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/208 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/123 (23%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 60/212 (28%)
GST_N_Phi 2..77 CDD:239351 27/73 (37%)
GST_C_Phi 92..208 CDD:198296 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.