DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF11

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:211 Identity:52/211 - (24%)
Similarity:98/211 - (46%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHA 70
            :||...:...:.|.|.....::.:|.::||:....|..|::|.:.|...||.:||....:::|.|
plant     5 VYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRA 69

  Fly    71 IIAYLVSKYADSDA-LYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP------ 128
            |..|..:||||... |..|....||:|||.:..|:...:|..: .:..:|:|:.::..|      
plant    70 IARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVAL-PLVMNVVFKPKSGKPCDVALV 133

  Fly   129 ---KERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFS------LVSSVASLEAFVALDTTKYPR 184
               |.::|.::::|   |..|....|:.|::.|:||.|      .:.:..||...|    |....
plant   134 EELKVKFDKVLDVY---ENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLV----TSREN 191

  Fly   185 IGAWIKKLEQLPYYEE 200
            :..|..::...|.:::
plant   192 LNRWWNEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 51/205 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/70 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/125 (22%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 52/211 (25%)
GST_N_Phi 2..77 CDD:239351 19/71 (27%)
GST_C_Phi 91..209 CDD:198296 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.