DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF10

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:221 Identity:62/221 - (28%)
Similarity:100/221 - (45%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            ||:|....:...||| :||....:::|.||||::...|..||||...|...:|.|.|..:.|::|
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    69 HAIIAYLVSKY-ADSDALYPKDPLKRAVVDQRLHFES------------GVVFANGIRSISKSVL 120
            .||:.|:..|| :....|..|...:|..|:|.|..|:            .:|||       ..:.
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFA-------PLMG 124

  Fly   121 FQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFS-------LVSSVASLEAFVALD 178
            |....||.||..:.:.|:.|..|..|...:|:||:.:::||.:       ||..:.  :|.:..|
plant   125 FPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIG--KAHLIKD 187

  Fly   179 TTKYPRIGAWIKKLEQLPYYEEANGK 204
            .   ..:.||..|:.....::|.:.|
plant   188 R---KHVSAWWDKISSRAAWKEVSAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 60/211 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/133 (23%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 62/221 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.