DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF9

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:222 Identity:57/222 - (25%)
Similarity:97/222 - (43%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDS 68
            |.:||...:.|.||: :||....:.:|.:.||::......|.||...|..|||.:.|..:.|::|
plant     3 LKVYGPHFASPKRAL-VTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAIIAYLVSKY-ADSDALYPKDPLKRAVVDQRLHFES------------GVVFANGIRSISKSVL 120
            .|::.|:..|| :....|..|....|..|:|.|..|:            .::||        ||:
plant    67 RAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFA--------SVM 123

  Fly   121 -FQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFS-------LVSSVASLEAFVAL 177
             |....|:.||..:.:..:.|..|..|....|:||:.:::||.:       ||..:.  :|::..
plant   124 GFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIG--KAYMIK 186

  Fly   178 DTTKYPRIGAWIKKLEQLPYYEEANGK 204
            |.   ..:.||...:...|.::|...|
plant   187 DR---KHVSAWWDDISSRPAWKETVAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 54/212 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/134 (22%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 57/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.