DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTF3

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:224 Identity:53/224 - (23%)
Similarity:94/224 - (41%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |..:.::|...|...|.|.:.|...||.:|.|:|::.........:|.:||...||..||....:
plant     1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WDSHAIIAYLVSKYADSDA-LYPKDPLKRA-----------------VVDQRLHFESGVVFANGI 112
            ::|.||..|:..:|.:... |.|.|....|                 .|..:|.:|....|..|:
plant    66 FESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGL 130

  Fly   113 RSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVAL 177
            .: .::|:.:.:.|:.|     ::::|   |..||...|:||...|:.|...:..:..|     |
plant   131 NT-DQAVVAEEEAKLAK-----VLDVY---EARLKEFKYLAGETFTLTDLHHIPVIQYL-----L 181

  Fly   178 DT------TKYPRIGAWIKKLEQLPYYEE 200
            .|      |:.||:..|:.::.:.|..|:
plant   182 GTPTKKLFTERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 50/215 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/133 (20%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 52/221 (24%)
GST_N_Phi 4..78 CDD:239351 21/73 (29%)
GST_C_Phi 96..212 CDD:198296 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.