DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and gstp1.2

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_571809.1 Gene:gstp1.2 / 79381 ZFINID:ZDB-GENE-020806-4 Length:208 Species:Danio rerio


Alignment Length:148 Identity:28/148 - (18%)
Similarity:68/148 - (45%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK-- 117
            :|..||....::.|:|::.:|..|:    |.|.|:..:.:::|         |..:|:..:..  
Zfish    53 LPKFEDGDLVLFQSNAMLRHLGRKH----AAYGKNDSEASLID---------VMNDGVEDLRLKY 104

  Fly   118 -SVLFQGQTKVPKERY--DAIIEIYDFVETFLKGQ-DYIAGNQLTIADFSLVSSVASLEAFVALD 178
             .:::| :.:..||.:  |....:..|.....|.: .::.|:|::.||::|...:.:|:......
Zfish   105 IKLIYQ-EYETGKEAFIKDLPNHLKCFENVLAKNKTGFLVGDQISFADYNLFDLLLNLKVLSPSC 168

  Fly   179 TTKYPRIGAWIKKLEQLP 196
            ...:|.:.:::.|:...|
Zfish   169 LDSFPSLKSFVDKISARP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 28/148 (19%)
gstp1.2NP_571809.1 GST_N_Pi 3..76 CDD:239374 6/22 (27%)
GST_C_Pi 84..208 CDD:198319 18/113 (16%)

Return to query results.
Submit another query.